PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G163200.1
Common NamePHAVU_009G163200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NAC
Protein Properties Length: 238aa    MW: 26946.1 Da    PI: 7.8856
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G163200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.74e-48141401128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Ptdeelv +yLk k+ + +l++ ++i+e+++ k++PwdLp ++  +eke yfFs+++ ky++g+r nr+t+sgyWkatg+dk+
  Phvul.009G163200.1  14 LPPGFRFQPTDEELVFQYLKCKIFSCQLPA-SIIPEINVSKYDPWDLPGNC-DDEKERYFFSSKEAKYRNGNRMNRTTNSGYWKATGSDKK 102
                         79****************************.89***************554.46789********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v s+ ++   gl+ktLvfy+g++p+g++t+W+mheyrl
  Phvul.009G163200.1 103 VSSSiNNGISGLRKTLVFYEGKSPNGSRTEWLMHEYRL 140
                         **9988889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5610165IPR003441NAC domain
PROSITE profilePS5100554.48914165IPR003441NAC domain
PfamPF023653.0E-2515140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MERLNFIKNG VSSLPPGFRF QPTDEELVFQ YLKCKIFSCQ LPASIIPEIN VSKYDPWDLP  60
GNCDDEKERY FFSSKEAKYR NGNRMNRTTN SGYWKATGSD KKVSSSINNG ISGLRKTLVF  120
YEGKSPNGSR TEWLMHEYRL LSVETSASKP IQEIGDWVLC RIFIKKRSIE SDNNTTPPRQ  180
KNAVTNNVEV AEPRFFEFFS VHHNSVPAPI HSSTLSSCSS SNNVEEVSSP NHEQTSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-481317016170NO APICAL MERISTEM PROTEIN
1ut4_B5e-481317016170NO APICAL MERISTEM PROTEIN
1ut7_A5e-481317016170NO APICAL MERISTEM PROTEIN
1ut7_B5e-481317016170NO APICAL MERISTEM PROTEIN
4dul_A5e-481317016170NAC domain-containing protein 19
4dul_B5e-481317016170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0926821e-167BT092682.1 Soybean clone JCVI-FLGm-16A18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007137875.11e-177hypothetical protein PHAVU_009G163200g
SwissprotQ9FY932e-74NAC83_ARATH; NAC domain-containing protein 83
TrEMBLV7AWB91e-177V7AWB9_PHAVU; Uncharacterized protein
STRINGGLYMA06G17480.11e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.17e-75NAC domain containing protein 83